Protein Info for mRNA_6526 in Rhodosporidium toruloides IFO0880

Name: 14894
Annotation: KOG2929 Transcription factor, component of CCR4 transcriptional complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 TIGR03317: folate-binding protein YgfZ" amino acids 220 to 281 (62 residues), 69 bits, see alignment E=1.3e-23

Best Hits

Predicted SEED Role

"Folate-dependent protein for Fe/S cluster synthesis/repair in oxidative stress"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>mRNA_6526 KOG2929 Transcription factor, component of CCR4 transcriptional complex (Rhodosporidium toruloides IFO0880)
MLLLSRTAHSPPASLRPCTCSFSRSFSLSARPLAPPYLYTQLTARALLAVSGQDSQKFLQ
GLVSNDVRRLAQKGEEDDPDKQRVLYANILKADGRYMHDIMLYSPLTPSADGIPAYLIEH
DSSFTSTLRTYFKRHKLRSKVKLGAAAEEELVVAAAWRNPADIGEGKSTAQELEEAERWL
EERKKGWDPRVVGMGRRWVEEKDGEKPPAELFAPVSPAHFQLHRLTHAVPEGPADFPALP
LEANIDLMNGVDYRKGCYVGQELTARTHHKGIVRKRGMVFRLFREGEDVPTEPVPSSASL
VPYPSLFPTPPPGSTLTLLSASSSPRARPSGKLGSSLPLVSQSGVQTITLAYGSVRTDQV
GDGADPNEGVFVVKAPVSETATVGSEGEAKSEAVELGDGAGESQEEGGRWLAKAFLPAWL
EFKLEEEAIAKGL