Protein Info for mRNA_6576 in Rhodosporidium toruloides IFO0880

Name: 14944
Annotation: K14709 SLC39A1_2_3, ZIP1_2_3 solute carrier family 39 (zinc transporter), member 1/2/3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 239 to 255 (17 residues), see Phobius details amino acids 267 to 292 (26 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details TIGR00820: ZIP zinc/iron transport family" amino acids 9 to 366 (358 residues), 271.1 bits, see alignment E=6.2e-85 PF02535: Zip" amino acids 17 to 362 (346 residues), 197.8 bits, see alignment E=1.5e-62

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>mRNA_6576 K14709 SLC39A1_2_3, ZIP1_2_3 solute carrier family 39 (zinc transporter), member 1/2/3 (Rhodosporidium toruloides IFO0880)
MADSSCGSGSSYNGNLDLRVGGLFLILGTSAIGTLFPILCRRSRLRISEHVYTAFKFFGS
GVIIATAFIHLLAPAFEALGSDCLHGAWKDYDWAPAIAMIAVFGIFLVELIATRTGASYL
KRRGLRHHDPHHVRGNEVGHTGHGTHPPADTTTTALASSGTSITQVDGAVAATPGDVDLE
AGEAKAHQRHDHGVLEEDDDLHESAVAQCIGVGILEIGVIFHSFIIGLTLAVSDNLGPLL
AVLTFHQTFEGIGLGSRLSSLPLPHRLNWVPIVAAVVYSCTTPLGIAVGLGVRETYNPES
AAASIVSGVLDASSAGILLWAGLVECLAHDLVFDRKMAEAPAREVAVAVFWVFLGAGLMA
LLGRWA