Protein Info for mRNA_6580 in Rhodosporidium toruloides IFO0880

Name: 14948
Annotation: K11098 SNRPF, SMF small nuclear ribonucleoprotein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 PF01423: LSM" amino acids 11 to 73 (63 residues), 74.7 bits, see alignment E=1.9e-25

Best Hits

Swiss-Prot: 78% identical to RUXF_HUMAN: Small nuclear ribonucleoprotein F (SNRPF) from Homo sapiens

KEGG orthology group: K11098, small nuclear ribonucleoprotein F (inferred from 86% identity to lbc:LACBIDRAFT_181948)

Predicted SEED Role

"Small nuclear ribonucleoprotein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (79 amino acids)

>mRNA_6580 K11098 SNRPF, SMF small nuclear ribonucleoprotein F (Rhodosporidium toruloides IFO0880)
MSAKIVNPKPFLSDLTGKPVMVRLKWGMEYKGYLVSTDSYMNLQLANTEEYQDGQSVGSL
GEVFIRCNNVLHIRGAEED