Protein Info for mRNA_6589 in Rhodosporidium toruloides IFO0880

Name: 14957
Annotation: K12386 CTNS cystinosin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details PF04193: PQ-loop" amino acids 8 to 65 (58 residues), 67 bits, see alignment E=5.2e-23 amino acids 151 to 205 (55 residues), 52.7 bits, see alignment E=1.4e-18 TIGR00951: lysosomal Cystine Transporter" amino acids 10 to 240 (231 residues), 225.1 bits, see alignment E=5.3e-71

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>mRNA_6589 K12386 CTNS cystinosin (Rhodosporidium toruloides IFO0880)
MLSFWTALSHLLGWTYTAAWSVSFYPQLILNWRRKSVTGLSIDFLTLNPLGFLCYSISNL
ALYASSTVRASYRARHDGHNPQVALNDVVFAVHACAVAGLTWGQSWVYQRDPSQRLSSYN
RLILLLLFLSLLTLTLLATLERLSYLSLVLFLSSVKLYVSAAKMVPQAWVNYRRKSTEGW
SIENILLDATGGLLSLTQLVLDSWVDGDWTGITGNPGKLGLSLLALAFDALFVVQHFVLY
RGRRGSSNGKEQEREDAEAAAGARARAGRGEQRGGSLGDRGALLAGEEEAADEDEEEEAS
VRRRGTEREPLLGRTRRGHERASSVSS