Protein Info for mRNA_6638 in Rhodosporidium toruloides IFO0880

Name: 15006
Annotation: K02575 NRT, narK, nrtP, nasA MFS transporter, NNP family, nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 67 to 89 (23 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details amino acids 440 to 460 (21 residues), see Phobius details amino acids 478 to 501 (24 residues), see Phobius details amino acids 509 to 529 (21 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 68 to 492 (425 residues), 350.9 bits, see alignment E=4.4e-109 PF07690: MFS_1" amino acids 73 to 494 (422 residues), 96.3 bits, see alignment E=9.1e-32

Best Hits

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>mRNA_6638 K02575 NRT, narK, nrtP, nasA MFS transporter, NNP family, nitrate/nitrite transporter (Rhodosporidium toruloides IFO0880)
MSDLEKRASNEIVAASSSDIEERHAQALHHGPPPFRWASLWEPAQINPLNGKSYTLPILR
LTDQYSINFHLAWLGFFVAFLSWFAFPPLIPEAIKKDLKLSTAQVGNSNIIALLATLVCR
FATGPLVDRFGPRYCMAALLVAGAIPSGLAGTISSAGGLYAVRFFIGVLGATFVPCLAWT
TAFFDKSIVGTANSFVGGWGNLGGGVTFVVQVATFQSLMNRGLSSHKAWRVCFAVVPVPI
LLFVAIATLVLGTDCPAGKWSARHTLPATAVAARQGHLAHLDASERAVVERKAREKAQGT
AHVQPADDEEDALAEIPLDVAVNEPLTFKTFITMISQPYTWLPTLMYMTTFGFELAVDAN
IASVLVANNRLTQLEAGYYGSTFGFLNLVTRPFGGFLADRLYARYGLKAKKYVTIVLGVL
EGAMSIAFGAYTLTKHNAGVAPSISVQMGVVTLMAIFSEVANGTNFSLAPHCNPFSNGFT
TGLVGAFGNLGGIWFALVFRYQVAKGYSNAWIICGAVAVGVNLFCILLPTPKK