Protein Info for mRNA_6654 in Rhodosporidium toruloides IFO0880

Name: 15022
Annotation: K12462 ARHGDI, RHOGDI Rho GDP-dissociation inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF02115: Rho_GDI" amino acids 19 to 202 (184 residues), 193.1 bits, see alignment E=2.3e-61

Best Hits

Swiss-Prot: 46% identical to GDIR2_HUMAN: Rho GDP-dissociation inhibitor 2 (ARHGDIB) from Homo sapiens

KEGG orthology group: K12462, Rho GDP-dissociation inhibitor (inferred from 58% identity to cnb:CNBG2150)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>mRNA_6654 K12462 ARHGDI, RHOGDI Rho GDP-dissociation inhibitor (Rhodosporidium toruloides IFO0880)
MSGHAPEPSSVNDDDLLPTETAGYKVGQAKTLEEYATLDAEDESLARWKASLGIGAGGAS
AAPSAGPSVQVLSLSLHSPSRPTPIELDLTQADKLKSLKKEPVTIKEGAEYSVEIKFRVN
NLVSGLKYIQAAKRAGMTVDKLESMIGSYGPSPEPVTKRFVTEEAPSGMLARSGSYTVRS
RVIDDDKNVYVDFEWTFKLAKEW