Protein Info for mRNA_6659 in Rhodosporidium toruloides IFO0880

Name: 15027
Annotation: K05663 ABC.ATM mitochondrial ABC transporter ATM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 146 to 172 (27 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 31 to 308 (278 residues), 140.8 bits, see alignment E=7.4e-45 PF00005: ABC_tran" amino acids 373 to 521 (149 residues), 118.8 bits, see alignment E=2.7e-38

Best Hits

Swiss-Prot: 69% identical to ATM1_CRYNJ: Iron-sulfur clusters transporter ATM1, mitochondrial (ATM1) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K05663, mitochondrial ABC transporter ATM (inferred from 68% identity to ppl:POSPLDRAFT_89920)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (616 amino acids)

>mRNA_6659 K05663 ABC.ATM mitochondrial ABC transporter ATM (Rhodosporidium toruloides IFO0880)
KEQTRRDWDIIKKLLPNVWPKNDWGTKTRVLLAIGLLIGGKLLNVQVPFFFKNIIDTLNV
EIDPTTGQGVFAIAGTVILGYGLARIGASLFSELRNAVFANVAQGAIRRVARSVFTHLLS
LDIGFHLTRQTGGLTRAIDRGTKGISFLLSSVVFHVVPTALEITMVCGILSYKFGWDFAA
VTLATMAAYSWFTIKTTAWRTKFRKQANAADNRAATMSVDSLINYEAVKYFNNEAFEVAQ
YDRAMKDYTKASVKISTSLAALNIGQNVIFSSALTGMMYLASKGIVDGSMTVGDLVMVNQ
LVFQLSLPLNFLGTVYRELRQSLIDMDTLFNLQSVGTTIKDAPNAKPLALTKGGEIRFEN
VAFGYHKDRPIFRDVSFTIPAGTKVGIVGPSGCGKSTVFRLLFRFYEPSSGKIFIDGQEL
HDIELESLRKEIGVVPQETPLFHSDIMHNIRYGRLDATDDEVKEAARLANVDRTIESLPD
KWKTKVGERGMMISGGEKQRMAVARVLLKDPKILFFDEATSALDSTTEVDLMRNINQTLL
SKARTSIFIAHRLKTVADADLIIVLRDGRVAEQGTHSELMSRGGLYRSMWDQQNSTLQEL
DEAEAVNEARSAEASV