Protein Info for mRNA_6679 in Rhodosporidium toruloides IFO0880

Name: 15047
Annotation: K05389 KCNKF potassium channel subfamily K, other eukaryote

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details PF07885: Ion_trans_2" amino acids 200 to 267 (68 residues), 38.2 bits, see alignment E=5.9e-14 amino acids 377 to 448 (72 residues), 54.3 bits, see alignment E=5.3e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (719 amino acids)

>mRNA_6679 K05389 KCNKF potassium channel subfamily K, other eukaryote (Rhodosporidium toruloides IFO0880)
MHASLEIVHERAHPRHRKWRTEAERKQAEAERQKQVAQRISSLVAQLLAPLTPLFALPGL
TEHWYVRRDASGFVTESKPDPPLIIAAGAVTLTVAILANLSILSRLVDTQPRFFTFSTIL
LLSIHCIVNLVALSVFGAEHAKPDGYYLSTAFWLSATSGCVALVSIVALLIDGTLTKWYH
EGGIGVTNKQRSLIVCFDTFVFLLLVGSVCYRYLITGATYLDTIYFCIQSFLTVGFGDVT
LDTTGSQIFSLFLNTIGILNFALLVTFTRATALEAMEEQYKTQERIIASRFRNRGAGSRL
FADVLSFFTCGLVHSREQQEEEQDAEDERHDEEEHGSDDGKKDEQGDQRRYEDAIVELRK
ERDREFRSQVVVAFSLFLVFWLVGAAAFAKLEGWSYWIGFYFVYVMATSIGYGDYSPQTQ
GGRAFFCVWAIGGAGVLTVLFSILADAYSQRFKKIFQHNIISTAFFAIFGHPPSHDSDSD
FKDRDAESHSHPKMSGLPMPPSSKEGSKEEVCVLPPSESEEDVRKSGEGREKKGAGMAER
KGRKEEDENCGSEDEDNDGAAKKERELGLKLLDLLGDTKRHLDHLIISDSDAKDKQVNRV
VRSLMQKENFSRSNWEHVEKNQDFKEFLYLRSLQAKLAELERLAQRTVGSSQDAQESKPS
GSGADQEKRGEEVQNESGSAEGGKSGKEKDVRGQAEERDENTKGKDPEGAESESSWAGS