Protein Info for mRNA_6702 in Rhodosporidium toruloides IFO0880

Name: 15070
Annotation: K08192 DAL MFS transporter, ACS family, allantoate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 56 to 76 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 289 to 314 (26 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details amino acids 445 to 466 (22 residues), see Phobius details PF07690: MFS_1" amino acids 63 to 431 (369 residues), 122 bits, see alignment E=1.4e-39

Best Hits

KEGG orthology group: None (inferred from 49% identity to aor:AOR_1_1468054)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>mRNA_6702 K08192 DAL MFS transporter, ACS family, allantoate permease (Rhodosporidium toruloides IFO0880)
MAPQHDVDIEKDQDGQKHVVITSVEGVDAAALATAAVAGRELDPAEARRLVRKIDLNILP
LMCFVYMIQFLDKVSLSYASIMGIRQQNHLTLGQYSWLSSIFYLAFLVGEWPTNYALQRL
PLAKWTSINVILWGGVLACTAATKNFQGLMAVRFFLGLLESCVSPAFSLVTSQWYKKNEQ
GTRTGIWFSCNALAQIFGALIAWGFAKHDMAGDFAIPGWKVLFLFLGGITMALGVLLLIF
LPDSPLNARFLTEHERVLAIERIRSNNSGIGNKKYKWYQVREALLDPLTWLYCLFAAANM
VINGGITSFFNILISSFGFSTLDSLLFGAPGGATVVVAVLLFLWLGDRFKKRCLCGICAL
LVGMLGMLLIWQLPTHYKVGRLIGYYLCNVFVAGFIVVFSLVGSNVAGSTKKSTVLAAFF
VAYACGNLIGPQTFRSKDAPRYAPALATSVALICFCIVDLALIWFITARRNRKRDEIMSS
PDYVARENVEFLDETDLENVAFRYVS