Protein Info for mRNA_6715 in Rhodosporidium toruloides IFO0880

Name: 15083
Annotation: K13989 DERL2_3 Derlin-2/3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details PF04511: DER1" amino acids 8 to 193 (186 residues), 111.2 bits, see alignment E=3.2e-36

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>mRNA_6715 K13989 DERL2_3 Derlin-2/3 (Rhodosporidium toruloides IFO0880)
MAAQLRKIPPFTRYTIFGVLGATLPTLLHLVSPYHLAFVPHRIAQNWELQRLVLPFLFGG
GGLNLVFSLIMLYRSLNELEEGHFQRRLADITWAFILICGMIIGLNTPLQTPFLFNPFMM
AVIHLWAQTHSANQVNLYGIITIPAPYFPFAMLGMDLLNGGPSAVLRSFTGMVAAHAYYF
LSVIYPRQSGGRQPALVRSLLTPPQTLINLLGNGPTVPSSYAAPGSSSTRTGSYRLGGGT
AYRPAGGASGAAAGARTMTGGAAAGGSSTATREQQAQHRWGRGTRLGTE