Protein Info for mRNA_6741 in Rhodosporidium toruloides IFO0880

Name: 15109
Annotation: K01657 trpE anthranilate synthase component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04715: Anth_synt_I_N" amino acids 41 to 176 (136 residues), 93.3 bits, see alignment E=1.6e-30 PF00425: Chorismate_bind" amino acids 250 to 506 (257 residues), 294.2 bits, see alignment E=9.8e-92

Best Hits

Predicted SEED Role

"Anthranilate synthase, aminase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>mRNA_6741 K01657 trpE anthranilate synthase component I (Rhodosporidium toruloides IFO0880)
MPPNLSHTLPEVLSLLLPSSSSSSPSPAGNCLPIWSTLPADVLTPVIVYLRLTDGAKNGE
SFLLEGAVKGETAGRWSYVGAGPKEVYRSGPGQDLGAVDPLKPLEKNLSKYKFIKVHGAP
PFTGGAIGYVGYDCIHYFEPKTARSDLSDPMGIPESVWLLHDTIVAFDHLFQRVYVVSHV
YLPDSSASESTIQASYDDAVKNIDAVLAKLLSTAPLPLPEQPPVTSAPIPANEKPEERYA
RLDKMSNVGKEGYERFVTSLKGSIVQGEIIQAVPSQRLRRETKLHPFNVYRHLRQLNPSP
YMFYINCGNGTQLVGASPECLCKVEEGGKVTNHAIAGTVRRGKTPAEDAALAAELSASMK
DRAEHVMLVDLARNDVNRVCKPETVVVDSLMQVEKFSHVMHLTSQVSGLLREGQTRFDAF
RSIFPAGTVSGAPKIRAIELISALELERRGVYAGAVGHFDFSSESMDTCIAIRTMVFKDG
VAFLQAGGGIVFDSVEEDEYVETVNKLGANVRCLEEAEAYYAALQAEQRQA