Protein Info for mRNA_6744 in Rhodosporidium toruloides IFO0880

Name: 15112
Annotation: KOG0813 Glyoxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF00753: Lactamase_B" amino acids 31 to 216 (186 residues), 33.9 bits, see alignment E=3.3e-12 PF17778: BLACT_WH" amino acids 317 to 359 (43 residues), 44 bits, see alignment 1.8e-15

Best Hits

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>mRNA_6744 KOG0813 Glyoxylase (Rhodosporidium toruloides IFO0880)
MASLPELPGVSTLSKYVTRVLGQNPGKFTLQGTNTYLVYHPASPSLLLLDTTGPSSASPL
SSSALQTYLSSLRSAIASHPTQPARITDIILTHWHRDHTAAVGDVVRMLAKLNGAEEAKV
RVWKFPCATGEGGSSDAWKSERTKDAELERDLEGLGGNELERTSDGTALHTLRAGQQFSL
APSGASPATNNTEDGVEFEVVHTPGHTSDSICVLLRDLSSSSPSSSATSPLALFTADTVL
GHGTAVFASLSAYLSSLASLIDLLSTSGSAPIPLYPGHGEVVTDGLAKIKEYKTHREDRE
KQVVEALKAVEGGEAVTAGELTDSIYADTIPSSLKLAATHGLLLHLEKLREEGRVGRVAQ
PSPEGLDLGAAGGGGEVQIPQGWFDGWRWVEASEAVEGRL