Protein Info for mRNA_6753 in Rhodosporidium toruloides IFO0880

Name: 15121
Annotation: K00999 CDIPT CDP-diacylglycerol--inositol 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 22 to 84 (63 residues), 49.8 bits, E=2.4e-17

Best Hits

KEGG orthology group: K00999, CDP-diacylglycerol--inositol 3-phosphatidyltransferase [EC: 2.7.8.11] (inferred from 62% identity to uma:UM00624.1)

Predicted SEED Role

No annotation

MetaCyc Pathways

• phosphatidylinositol biosynthesis II (eukaryotes) (1/1 steps found)
• D-myo-inositol (1,4,5)-trisphosphate biosynthesis (3/5 steps found)
• 3-phosphoinositide biosynthesis (4/8 steps found)
• superpathway of phospholipid biosynthesis II (plants) (15/28 steps found)
• superpathway of inositol phosphate compounds (5/29 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Inositol phosphate metabolism
• Phosphatidylinositol signaling system

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.11

Protein Sequence (251 amino acids)

>mRNA_6753 K00999 CDIPT CDP-diacylglycerol--inositol 3-phosphatidyltransferase (Rhodosporidium toruloides IFO0880)
MSRSPSPAAPRPRTDENVFLFAPNLIGYTRVILGAAALTYMTTHPKFCTVAYCVSALLDA
VDGQVARALGQTSKFGAILDMVTDRCMTSCLLCFLASAYPRAALLFQFLISLDFSSHYIH
MYASISSGSRSHKTVTKEQSWILWSYYNNSRTLFIFCAANELFFVALYVLSNYHKPLLTS
LHALPPSLLALPAPVLKMVLKTSWPHVVAVLTAPIMVGKQIINVVQFWKAAKALTEADQE
ERYAMQMAKKQ