Protein Info for mRNA_6755 in Rhodosporidium toruloides IFO0880

Name: 15123
Annotation: K14319 RANGAP1 Ran GTPase-activating protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF13516: LRR_6" amino acids 93 to 110 (18 residues), 12.3 bits, see alignment (E = 7.7e-06) amino acids 120 to 141 (22 residues), 9.2 bits, see alignment (E = 7.6e-05) amino acids 243 to 262 (20 residues), 10.7 bits, see alignment (E = 2.6e-05)

Best Hits

KEGG orthology group: K14319, Ran GTPase-activating protein 1 (inferred from 56% identity to cne:CND03210)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>mRNA_6755 K14319 RANGAP1 Ran GTPase-activating protein 1 (Rhodosporidium toruloides IFO0880)
MTTFTLGHQLKLDSLEHTQPHLDRLRQLGPNVEEVRFGGNTLGIEACEGVAKELEDKREL
RIADFSDIFTGRLITEIPQSLRALCTSLLTLPLLTELDLSDNAFGGRSAEPMLDFISSAP
SLEILRLNNNGMGPQGGAMIAGALLENAKKAEKEGRKSKLRVLVCGRNRLENGSAPDFAA
AFSALTTLAEVRMPQNGIRMEGIEAIVKGLQKNPNLQWLDLQDNTATEKGSRAIAESLPF
WPKLRILNLSDCLLRPRGGLSIFTTLLSGSNPLLTSLKLQSNELDTRAITQLAAAIALHG
EHLTDLELNGNYGVDGTEEEYEKVREALGKWDHEDALDELDELEEPEEEEEEEESEKEAE
VEEEEEKPEVKEETKEEKKEEDELAGLMDKVHIA