Protein Info for mRNA_6794 in Rhodosporidium toruloides IFO0880

Name: 15162
Annotation: K10773 NTH endonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF00730: HhH-GPD" amino acids 158 to 297 (140 residues), 62.4 bits, see alignment E=5.3e-21

Best Hits

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>mRNA_6794 K10773 NTH endonuclease III (Rhodosporidium toruloides IFO0880)
MAPLKMRTSTYSSRVTIYENSSPATSSETAASTSTTPAAASPRRTTRSSAAAAFAEAQTL
GLSLPDAKEDFEEDVKPAKKARSPRKPKPHVERLAVPHPAPKRWEETYEVIRKQRERIIA
PVDTMGCEQGGKEAKVEDEEVKPQRVETEKDRRLSVIVSLMLSSQTKDPVTHQATMNLRN
QLPGGLTLEGLETATVDEIDTAICKVGFHNTKAKNLKLLATRLRDLHDGDVPDDLPSLLA
INGVGPKMAYLYLQAIGKNAGIGVDTHVHRITNRLRWHKKETTTPEQTRLNLESWLPRHL
WPTVNKMLVGFGQEVCKPVAPRCDLCDVATAKLCPSRRVVVASPAKKRVKVEVKEEQTDG
QPQVELALEQAEQVLEQIVVAVKQEDSGVLRVEERVVKTEHAT