Protein Info for mRNA_6801 in Rhodosporidium toruloides IFO0880

Name: 15169
Annotation: K15279 SLC35C1, FUCT1 solute carrier family 35 (GDP-fucose transporter), member C1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 253 to 277 (25 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details PF03151: TPT" amino acids 45 to 328 (284 residues), 72.3 bits, see alignment E=4.6e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>mRNA_6801 K15279 SLC35C1, FUCT1 solute carrier family 35 (GDP-fucose transporter), member C1 (Rhodosporidium toruloides IFO0880)
MAQRGDYQRVPVNDDIEMKGSHRDGTPQPPKTEEPPSTGMVVFSVSFYLVAAIVMIMVNK
WVLNKVQIPLFFLFCQLLIAVFLLQLCALFGYMKLPRLDITTCKGLAPLIGCNVLGLAFN
TYCLQYVDASFYQIARGLVLPFTVFFSWYILGSKSSRATLTAVGIVCIGFMLGVSGEIHT
TLLGTTLGVASSVTTAVHAIVVKRSLGVVSGTLDLAYYTNLLSAIVILPFVILSGEVWTV
VEMVAGNGDGAEAFGTFMTGAAVTGLFGFLICIAGFLSIKVTSPISHMISAAVRGVLQTF
LGVWLFKDQVGAGRAFGIVFILIGSIYYVYTKSQENAAPRSAPPSSPEIHGNRGGPSVLS
AGQTPGLVYSASFIGEEKERR