Protein Info for mRNA_6869 in Rhodosporidium toruloides IFO0880

Name: 15237
Annotation: K06125 COQ2 4-hydroxybenzoate polyprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01474: 4-hydroxybenzoate polyprenyl transferase
  • amino acids 1 to 276 (276 residues), 339.1 bits, E=1.1e-105
• PF01040: UbiA
  • amino acids 11 to 258 (248 residues), 180.4 bits, E=2.1e-57

Best Hits

Swiss-Prot: 48% identical to PGT1_LITER: 4-hydroxybenzoate geranyltransferase 1 (PGT-1) from Lithospermum erythrorhizon

KEGG orthology group: None (inferred from 60% identity to smo:SELMODRAFT_24149)

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (3/8 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (5/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of chorismate metabolism (28/59 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.39

Protein Sequence (284 amino acids)

>mRNA_6869 K06125 COQ2 4-hydroxybenzoate polyprenyltransferase (Rhodosporidium toruloides IFO0880)
MDKPIGTWLLYWPCAWGITMAAYSSALPVSSWAWNLALFGTGAIVMRGAGCTINDLWDRN
IDKKVDRTKMRPIASGEVKPIQAITFLGGQLSVGLAILTQLNWYSIGLGASSLSLVVLYP
LMKRITYWPQFVLGMAFNWGALLGSSAVLGVCDWQVALPLYAGSIAWTIVYDTIYAHQDK
VDDVKAGVKSTALLFAERSRPILTAFSASFVSLLALSGYLNAQGPAFYALSVGGAAVHLA
WQLRNADLDSRESCWEMFKSNRDLGAIVWSGMAVDYALKLSGMM