Protein Info for mRNA_6877 in Rhodosporidium toruloides IFO0880

Name: 15245
Annotation: KOG3912 Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 244 to 270 (27 residues), see Phobius details amino acids 297 to 319 (23 residues), see Phobius details amino acids 356 to 384 (29 residues), see Phobius details PF04142: Nuc_sug_transp" amino acids 115 to 237 (123 residues), 36.3 bits, see alignment E=2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>mRNA_6877 KOG3912 Predicted integral membrane protein (Rhodosporidium toruloides IFO0880)
MSSTVRRPSAQVIGLLVIGMLVCGCSNSIFTKWQDMQCVANCGPLDDPTTRKTFEQPVWQ
TATMFVGETFCLMAFSLINSRLNLFARPVKGGISLPTDDVVVEGKEEAKKMRFSDAILFW
LPAVCDILGTTFMSIGLLFIPVSVYQMLRGALVLWVGLFSVLFLQRRLTRAQWVALGVIM
LGVGIVGAASLIQDKNPTTQPEAESAEKDVSPLVGVGLVLLAQVFTASQFVIEERIMEHH
SVEPLLAAGYEGICGLLTTLSGLFLIYRFYGSTAAGRGGYFDAPEGWHQIIEHRSVWSTS
IVIAISIALFNFCGLAVTRSWVASLCSWRPPLKLTLPFARSVSATSRSTIDSCRTLLIWV
VSLALGWESFVFLQVIGFVLLVYGTFVHNGILAFPHWTGLREIELPGVEADDPLDSDYDD
ERNTTSPGGIATPPFTPSPVQRRTAETQPLLKTAQE