Protein Info for mRNA_6889 in Rhodosporidium toruloides IFO0880

Name: 15257
Annotation: K17065 DNM1L dynamin 1-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 PF00350: Dynamin_N" amino acids 31 to 229 (199 residues), 186.3 bits, see alignment E=9.6e-59 PF01031: Dynamin_M" amino acids 238 to 524 (287 residues), 347.7 bits, see alignment E=9.9e-108 PF02212: GED" amino acids 610 to 701 (92 residues), 96.5 bits, see alignment E=1.7e-31

Best Hits

Swiss-Prot: 57% identical to VPS1_YEAST: Vacuolar protein sorting-associated protein 1 (VPS1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 70% identity to lbc:LACBIDRAFT_172764)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (702 amino acids)

>mRNA_6889 K17065 DNM1L dynamin 1-like protein (Rhodosporidium toruloides IFO0880)
MDQQLIKTVNLLQDAFAQSGLSTSTIDLPQIAVVGSQSSGKSSVLENIVGRDFLPRGTGI
VTRRPLVLQLINRPATPKANGDAKQEEGSKPTTDKASNPDEWAEFLHRPGEKFFDFNKVR
EEIVADTELKTGKNAGISPVPIGLRIFSPNVLTLTLVDLPGLTKVPVGDQPRDIEIQIRN
MLLKYIQKPNSIILAVTAANTDLANSDGLKLAREVDPEGLRTIGVLTKVDLMDQGTDVVD
ILAGRVIPLRLGYVPVVNRSQRDIDNNRPIHAALDSERQFFENHPSYRSKASYCGTPYLT
RRLNTILMHHIKATLPDIKQKISQNLTKYEAELASLGGPNGGTDGSSVILQIITEFCGDF
RTAIDGSSSDLALNELSGGARVSFVFHELFSNGVKSLDPFDHVKDADIRTILYNSSGSSP
ALFVGTTAFEVIIKQQIKRIEEPSLKCASLVYDELMRILAQLLNKNTAFKRYPGLRDRFY
STVQNFFRKRMVPTNKLVQDLVAMESSYINTGHPDFISGHKAMAIVSERMNQNKPQNAGP
AVDPKTGKLAPGTLNNGKDLDVDLKQKEEGFFGSFWPGGRKNQAIAQKKGAAAMDAPPPA
LRATGTLSEREQMETEVIKLLISSYFALSKRTLIDMVPKAIMLNLVFHARDSMQRELLSE
LYKTEMIEEMLKESDSVVQRRKECVKMVAALNKAESIVASVA