Protein Info for mRNA_6895 in Rhodosporidium toruloides IFO0880

Name: 15263
Annotation: K18183 COX19 cytochrome c oxidase assembly protein subunit 19

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 46% identical to COX19_PARBR: Cytochrome c oxidase assembly protein COX19 (COX19) from Paracoccidioides brasiliensis

KEGG orthology group: None (inferred from 50% identity to pcs:Pc16g06310)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>mRNA_6895 K18183 COX19 cytochrome c oxidase assembly protein subunit 19 (Rhodosporidium toruloides IFO0880)
MSFGRPANTSLSLGGAPPLKGSFPLDHDGECKDYMVRYLKCMKQNKNQSTECRYLSKEYL
ACRMDKGLMERTDFEALGFQEGEKGAGEAAGTQPTAQAKHQQPPTAAW