Protein Info for mRNA_6966 in Rhodosporidium toruloides IFO0880

Name: 15334
Annotation: K02210 MCM7, CDC47 DNA replication licensing factor MCM7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 769 PF14551: MCM_N" amino acids 20 to 169 (150 residues), 65.7 bits, see alignment E=1.5e-21 PF17207: MCM_OB" amino acids 179 to 309 (131 residues), 104.4 bits, see alignment E=1.2e-33 PF00493: MCM" amino acids 351 to 571 (221 residues), 343.7 bits, see alignment E=1e-106 PF07728: AAA_5" amino acids 407 to 533 (127 residues), 29.5 bits, see alignment E=2.1e-10 PF01078: Mg_chelatase" amino acids 461 to 522 (62 residues), 24.1 bits, see alignment 6.8e-09 PF17855: MCM_lid" amino acids 589 to 675 (87 residues), 71 bits, see alignment E=2.8e-23

Best Hits

Swiss-Prot: 60% identical to MCM7_SCHPO: DNA replication licensing factor mcm7 (mcm7) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02210, minichromosome maintenance protein 7 (cell division control protein 47) (inferred from 67% identity to cnb:CNBF3160)

Predicted SEED Role

"DNA replication helicase protein MCM" in subsystem DNA replication, archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (769 amino acids)

>mRNA_6966 K02210 MCM7, CDC47 DNA replication licensing factor MCM7 (Rhodosporidium toruloides IFO0880)
MASALPTINLGLDYEEDLDQIKNFLTKFKTRPGKRRALPEDEDLENVDMDEDVQEGEDAA
PREKYVEMLQRVANRDEERIVIDLEDLKEDGDMGRALVAQIQRNTQRYIKLFSRAIDEVM
PQNTVDIGPKSDILDVMQYHRNNKNQQNEEAGQAVFPPQLLRRYNLYFRPLANEPSLAVR
QVRGAHLGKLITVRGIVTRVSEVKPLLQVNAYTCDSCGAEIFQDVQGRKVTPLDACISEV
CTQNQSRGQLYMQTRASKFTPFQECRIQEMADQVPVGHIPRTMVIHLYGNQTRAVSPGDV
VNISGIFLPIPYEGLKAMRMGLLTDSYLEAHHVQQLKKQYEAMQLTPEITREIEEIKAVP
GLFSRLASSIAPEIFGHEDVKRALLLLLVGGVTKAVGDGMKIRGDINVCLMGDPGVAKSQ
LLKYIAKVAPRGVYTTGRGSSGVGLTAAVLRDPVTDEFVLEGGALVLADNGICCIDEFDK
MDDSDRTAIHEVMEQQTISISKAGITTTLNARTSILAAANPLYGRYNPKISPVDNINLPA
ALLSRFDLLFLILDTPTRDDDERLAQHVTFVHMNREAPPLALEPISPTVLRHYIALARQV
RPVVPKVVADMVVNEYTSLRRRQKQEDEKNQFFTYTSARTLLGVLRLAQACARLRFSPEV
DVDDVKEALRLMEASKASLHEHEHRDAGEDRSSRTRIYHLVKSMLSDALMDVDDDAAADD
FEETLRMADIRDRAFAAGFTQDELDDALAAYSELGVFYLSDDGATLTFA