Protein Info for mRNA_6971 in Rhodosporidium toruloides IFO0880

Name: 15339
Annotation: K03671 trxA thioredoxin 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 140 to 157 (18 residues), see Phobius details PF14595: Thioredoxin_9" amino acids 10 to 91 (82 residues), 26.8 bits, see alignment E=1.4e-09 PF04756: OST3_OST6" amino acids 13 to 156 (144 residues), 33.3 bits, see alignment E=1.2e-11 PF13098: Thioredoxin_2" amino acids 18 to 95 (78 residues), 32.3 bits, see alignment E=4.3e-11 PF00085: Thioredoxin" amino acids 19 to 104 (86 residues), 94.2 bits, see alignment E=1.6e-30

Best Hits

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>mRNA_6971 K03671 trxA thioredoxin 1 (Rhodosporidium toruloides IFO0880)
MSAITHLTSLPELNKLLAAKKERLVVIDFHATWCGPCHAIAPTFEKLANQYRQATFCKVD
VDAAQEIARAYSVRAMPTFVFIKNERKVHEVKGANASAIEAGIKQYVGSSGGEAGAFPGQ
GHTLTGTPVPTEAPPAEANYVRWLIFGALALWWFWSARQSKEQ