Protein Info for mRNA_6989 in Rhodosporidium toruloides IFO0880

Name: 15357
Annotation: K11836 USP5_13, UBP14 ubiquitin carboxyl-terminal hydrolase 5/13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 840 PF17807: zf-UBP_var" amino acids 14 to 85 (72 residues), 79 bits, see alignment E=4.6e-26 PF02148: zf-UBP" amino acids 201 to 273 (73 residues), 71.8 bits, see alignment E=1.2e-23 PF00443: UCH" amino acids 313 to 834 (522 residues), 131.5 bits, see alignment E=1e-41 PF13423: UCH_1" amino acids 423 to 813 (391 residues), 47.8 bits, see alignment E=4.1e-16 PF00627: UBA" amino acids 632 to 668 (37 residues), 32.5 bits, see alignment (E = 1.6e-11) amino acids 696 to 731 (36 residues), 44.5 bits, see alignment (E = 2.9e-15)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (840 amino acids)

>mRNA_6989 K11836 USP5_13, UBP14 ubiquitin carboxyl-terminal hydrolase 5/13 (Rhodosporidium toruloides IFO0880)
MTAVPAELLTALQPPRPSQTVYREECTQCFDSHDSAAGVDVCLHCFNGGCPPAINGVESA
NGHGRLHFERTGHRVVVNIQRRRKPASELRRNKRDSNEPPVKKLAIREEPSEAEKYDFHT
QVRMYTGGEGDRATAQYVVVEQVDEKLSGLVAAVLSAMSSAQRSEVKAWEEEIVPCQHTR
ELVQPEPKKLEPAGLASCAHADCGLTSNLWLCLTCGALGCGRQQYGGGGGNGHALKHTSD
TGHPVAVKLGTIEPDGSADVYCYACDDARIDPNLAKHLANFGIEQVEQNRTFDFAMTGAD
GKELEPLFGPGLTGMKNLGNSCYMASSLQSVFSLPIFQDRYLTSFVIHPQTCTNPSPATC
FECQMSKIADGLLSGRYAVPHVPEPSDALAGSDNQAPADADKPRVHFQEGIRPAMFKALV
GKDHAEFSTMRQQDAGEFLQHLLEYIRRASKSLGVEEPTGIFGFAVEERLECSQCHGVRY
KTQNEELLSLPVPVKKREVMDIEATPGEASAGGEARTTYEQDKDRKIEYEPVQLTDCLSN
LTSPTETEYKCPACDAKVTAVKSTRFSTFPDVLLVNAARFQLDGWVPRKVDVPVVVPFTD
LDMSPFVGKGLQQGENELPADKEDAPAEPQFDAEAMNQLTGMGFPEIRAKRALLATGHNG
AEVAMNWLFEHMEDPDIDDPLPAATSSASSAAADPSPESISTVCEMGFTPAQARKALRET
GGSIERAVEWLFSHPDDDGSDPAPAASTGAGGGAEKKLPGSKDLPARYRLKAFISHKGPS
VHSGHYVAHVWTGQADSTGGGKGGWVLFNDEKVVRADEGEQAAERLSPFAYVYVFERVRE