Protein Info for mRNA_7003 in Rhodosporidium toruloides IFO0880

Name: 15371
Annotation: KOG2394 WD40 protein DMR-N9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 PF00400: WD40" amino acids 424 to 460 (37 residues), 17.4 bits, see alignment 6.5e-07 amino acids 475 to 498 (24 residues), 16.6 bits, see alignment (E = 1.2e-06) amino acids 509 to 549 (41 residues), 14.3 bits, see alignment 6.2e-06

Best Hits

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (679 amino acids)

>mRNA_7003 KOG2394 WD40 protein DMR-N9 (Rhodosporidium toruloides IFO0880)
MADLNLPPQSFFAAPEGVYTLVSQQSIVPTSNTIGSSTAHFTPALGIAPPVSVGLNGAPA
QSDQTQPAAPPLYPSRLAAVSVRLPLKEGGAGLAGLGMSIGRGRGKEQDGGSSAGMTASF
TSDGSAERDGANGAGGSGTGGSNNPPPSSPLLKRKPLTSSFSMLGGLSLAAGDGAGGAVP
TSRPARPFKGSSSSFIRSWEGLPISQVQLRAIAEANAGRDTIFGFQTLGKAVVWTEIGKG
KKDSLSRVIFANFPTCIDANQHTASHTQVDVLIGFNSGDIVWMDPLTARYSRFNKSGCIT
SSAVTSILWLPPAPPKSPSSPSIDPSSPSTTTRSNLFVTSHADGSIILWDKDKEDWSGFV
PQAYPPPKGANSPVTGQKENEWPLAGAGAATMGAGKMADGQEDMVVSKLPPTDRKGQSTA
KLNPVSHWRVSKKPINALAFSPDLALCAAAGEDGCLRIIDAVEEKLLDCFSSYFGALLCV
AWSPDGRFVVTGGQDDLVTVYAPLEQHIVAHCQGHASWVTSVAWDAWRSEDRTLRIASVG
EDCKLILWDLSSASLTRPKAHAHPHVRRHSASSQVSLNRRSNSESAWHLPLDRAERSAGP
AFHPAPRRDDVSLLQPVAVKVLSTDLFSGVQILPDYVLLATRGGQVKQYDRPPIHESLLG
GLSSEFAASVVRLDARARG