Protein Info for mRNA_7021 in Rhodosporidium toruloides IFO0880

Name: 15389
Annotation: K21027 TRMU, SLM3 tRNA-5-taurinomethyluridine 2-sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 63 to 427 (365 residues), 309.3 bits, see alignment E=1.5e-96 PF02568: ThiI" amino acids 63 to 101 (39 residues), 21.4 bits, see alignment 1.7e-08 PF03054: tRNA_Me_trans" amino acids 63 to 427 (365 residues), 342 bits, see alignment E=3.5e-106

Best Hits

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>mRNA_7021 K21027 TRMU, SLM3 tRNA-5-taurinomethyluridine 2-sulfurtransferase (Rhodosporidium toruloides IFO0880)
MLASGVARLGGRSSLGVVSMGARRARQRGTTTDVARWLTTIVRRQQEQEREAATWGPPPA
GTKVFACMSGGVDSSVAARLLLEQGYDVEPVFMRNWDTLDEQSESGGCEWERDWEDVRTV
CRENLGGLKPRLVDLSREYWSHVFEPALEGWAAGVTPNPDVTCNQHIKFRVLPERLLAKD
PSAWIATGHWARLGPSPLDPSQPALFRSANIGKDQSHYLSTSPISALRRTLFPLGAYSSK
DDVRDLAREWGMHTGEKKDSMGICFVGVRKGFSGFLDSYLPPSPGNILDANGKVVGRHNG
LWRYTVGERARIGGQSEAMFIANKDAKSNTITIVPKSHPMLRCVSLLSNNFRWISSSHPP
HEVDSPQGFECKAQTRSLPFGALAKCTVRRWGKGSLDIDLHEPLVGVSPGQTVALYKGDW
CLGGGTIQSTLTLADRPEGEVAEAVEDRPQLSRAVAK