Protein Info for mRNA_7036 in Rhodosporidium toruloides IFO0880

Name: 15404
Annotation: K00831 serC, PSAT1 phosphoserine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00266: Aminotran_5
  • amino acids 1 to 392 (392 residues), 110.3 bits, E=5.4e-36

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (3/4 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
• L-serine biosynthesis I (2/3 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (3/7 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Protein Sequence (404 amino acids)

>mRNA_7036 K00831 serC, PSAT1 phosphoserine aminotransferase (Rhodosporidium toruloides IFO0880)
MNAGPSPLPDAALLTAAASLLSYPETPGMGIAEISHRSPAFDNVVVKANDSLRKLLEIPS
NYRILWMQGGGLTQFAATALNLLAWYRIKNQLKPEDEVDAWYAVTGSWSKKAAEEGARVG
VNAKKVFDGKKYGGGKFKGIPPASEWDIPQLEENGRKPAFVYYCDNETVDGIEFGGVGSE
TSFPFDKFDPEVPVVADMSSNFLSRPVDVSKYGIIYAGAQKNLGPAGVTLVIVREDLIVD
LDEAVKYGGTRVPSMLSYKNMADTNSMYNTPPTFTIYVCSLVLRSLLASPPLPLSSPDAR
PLSPLSDFADQKSSLIYAELDDGSGFYVGTADKAVRSRMNPTFRLNGGEELEKKFVKAAS
EKGIKGVNGHRSVGGIRTSIYNAVTLDQVKTLVAFMREFRDQNQ