Protein Info for mRNA_7055 in Rhodosporidium toruloides IFO0880

Name: 15423
Annotation: K03841 FBP, fbp fructose-1,6-bisphosphatase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 16 to 204 (189 residues), 235.5 bits, E=1.7e-74

Best Hits

Swiss-Prot: 61% identical to F16P2_ORYSI: Fructose-1,6-bisphosphatase, cytosolic (OsI_04558) from Oryza sativa subsp. indica

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 76% identity to scm:SCHCODRAFT_74131)

MetaCyc: 59% identical to fructose-1,6-bisphosphatase (Arabidopsis thaliana col)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Protein Sequence (339 amino acids)

>mRNA_7055 K03841 FBP, fbp fructose-1,6-bisphosphatase I (Rhodosporidium toruloides IFO0880)
MSHTGFDEGAPKTEIITLTSHVLSQQQRHPIATGDLTLLLTAIQTTCKFISTNVRRAGLL
NLIGAAGSANVQGEDQKKLDILSNDIMVNSLRASGKTAVLVSEEIDDPIIIDAAHRGRYC
VVFDPLDGSSNIDAGVNIGTIFGVYKCADDSDGKVEDVLRPGSELQVAGYCMYGSSANLV
ISTGQGVNGYTLDNGIGEFILTHPNIRIPDRGKIYSFNEGNSLWWPDHVNKYLESVKFPE
NGKPYSARYIGSMVADVHRTLLYGGIFGYPADKKSKSGKLRLLYEAFPMAFLVEQAGGLA
TTGTKRILDIQPTSIHERTPIYLGSKEDVEDLMKFFKDQ