Protein Info for mRNA_7074 in Rhodosporidium toruloides IFO0880

Name: 15442
Annotation: K02218 CSNK1, CKI casein kinase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF07714: Pkinase_Tyr" amino acids 26 to 250 (225 residues), 47.1 bits, see alignment E=2.9e-16 PF00069: Pkinase" amino acids 26 to 245 (220 residues), 92.1 bits, see alignment E=6.1e-30 PF17667: Pkinase_fungal" amino acids 135 to 223 (89 residues), 28.1 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 61% identical to KC1G1_MACFA: Casein kinase I isoform gamma-1 (CSNK1G1) from Macaca fascicularis

KEGG orthology group: K02218, casein kinase 1 [EC: 2.7.11.1] (inferred from 87% identity to scm:SCHCODRAFT_52195)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>mRNA_7074 K02218 CSNK1, CKI casein kinase 1 (Rhodosporidium toruloides IFO0880)
MSATAAHHSSSHSGSSSSNVIGVHFRVGRKIGEGSFGVIFEGTNLLNSQTVAIKFEPRKS
DAPQLRDEYRTYKILAGSVGIPQVYYFGQEGLHNVLVIDLLGPSLEDLFDMCGRKFSIKT
VCMTAKQMLSRVQTIHEKNLIYRDIKPDNFLIGRPGTKNANLVHVVDFGMAKQYRDPKTK
QHIPYRERKSLSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGGLPWQGLKAATNK
QKYEKIGEKKQSTPIKELAEGFPDEFAIYLNYVRKLGFEETPDYDFLRELFSKVLKNMGE
SDDGVYDWMLLNNGKGWEAGVRWRSLSVVCSAFSRAPC