Protein Info for mRNA_7128 in Rhodosporidium toruloides IFO0880

Name: 15496
Annotation: K00939 adk, AK adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01351: adenylate kinase
  • amino acids 71 to 282 (212 residues), 258 bits, E=3.4e-81
• PF00406: ADK
  • amino acids 74 to 260 (187 residues), 197.5 bits, E=2e-62
• PF13207: AAA_17
  • amino acids 75 to 206 (132 residues), 82 bits, E=8.4e-27
• PF05191: ADK_lid
  • amino acids 197 to 232 (36 residues), 59.3 bits, 4.3e-20

Best Hits

Swiss-Prot: 66% identical to KAD2_USTMA: Adenylate kinase (ADK1) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 66% identity to uma:UM02088.1)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.3

Protein Sequence (288 amino acids)

>mRNA_7128 K00939 adk, AK adenylate kinase (Rhodosporidium toruloides IFO0880)
MSSDNIEHLKGLVSQLQAKIERLEKQAQQTASDAKHKVGEAVDQAKDVVKGTIADATGSA
QKTLTPAQHLRLVLMGPPGAGKGTQAPKIKETYNVCHLATGDMLREEVKKGSELGKEAKK
IMDNGGLVSDEIVIGMIGSQLENNPECQLGFILDGFPRNVTQAEKLDEMLAKRKQPLEHA
VQLLVNDNLLVSRITGRLIHPASGRSYHKEFAPPKKPMTDDVTGEPLIQRSDDTAETLWK
RLETYHKQTDPVADYYKKKGIWTGVDAAQSPKTVWASLSKIFEETKKQ