Protein Info for mRNA_7285 in Rhodosporidium toruloides IFO0880

Name: 15653
Annotation: HMMPfam-GPR1/FUN34/yaaH family-PF01184,ProSitePatterns-GPR1/FUN34/yaaH family signature.-PS01114

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 39 to 236 (198 residues), 183.6 bits, see alignment E=1.8e-58

Best Hits

KEGG orthology group: K07034, (no description) (inferred from 37% identity to uma:UM00196.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>mRNA_7285 HMMPfam-GPR1/FUN34/yaaH family-PF01184,ProSitePatterns-GPR1/FUN34/yaaH family signature.-PS01114 (Rhodosporidium toruloides IFO0880)
MSQASNTDLEKNATEHYEGRPLAHVVTPGGNPADYSQPALPQYHRKVANPAPLGLVSFAA
GYWLASVLTLYARGVEIPNVVVPVLALFGGLMQTIVGLVEMFLGNTWGATVFCSFGSFNF
TYAALYLPAFGVAAAYTRADGTLDPSFNQAVGLYLLMWALCVGFFVIGALRTSVSVLSTL
VFTFLNFVTLAVWKLDGSDTARIVGGVFGLCASACATWGAAAGFYTSDATFGFLQPSPIN
LRRD