Protein Info for mRNA_7315 in Rhodosporidium toruloides IFO0880

Name: 15683
Annotation: K05527 bolA BolA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF01722: BolA" amino acids 50 to 131 (82 residues), 105.9 bits, see alignment E=5.4e-35

Best Hits

KEGG orthology group: K05527, BolA protein (inferred from 40% identity to afm:AFUA_7G01520)

Predicted SEED Role

"Cell division protein BolA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>mRNA_7315 K05527 bolA BolA protein (Rhodosporidium toruloides IFO0880)
MLARQLAPRRLLSSSLVRPAHFASRMSTSAQAQGGEKAAGPVEQSIRDKLTTALTPSFLA
ISNDSHLHRHHAPMKAIGGGGGETHFTVQVVSDKFEGLRQIQRHRLVNETLKSEFDAGLH
ALSIKAKSPTEYNKEQTA