Protein Info for mRNA_7324 in Rhodosporidium toruloides IFO0880

Name: 15692
Annotation: K20967 MOCS1 GTP 3',8-cyclase / cyclic pyranopterin monophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 84 to 369 (286 residues), 322.8 bits, see alignment E=2.2e-100 PF04055: Radical_SAM" amino acids 98 to 256 (159 residues), 97.6 bits, see alignment E=2.3e-31 PF13353: Fer4_12" amino acids 100 to 183 (84 residues), 26.1 bits, see alignment E=1.9e-09 PF06463: Mob_synth_C" amino acids 264 to 369 (106 residues), 88.4 bits, see alignment E=7.8e-29 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 516 to 674 (159 residues), 152.9 bits, see alignment E=5.3e-49 PF01967: MoaC" amino acids 527 to 672 (146 residues), 168.5 bits, see alignment E=1.7e-53

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (681 amino acids)

>mRNA_7324 K20967 MOCS1 GTP 3',8-cyclase / cyclic pyranopterin monophosphate synthase (Rhodosporidium toruloides IFO0880)
MLATTRTAPARLTRAIHAVPAAKEPLARPLAHSSAPHPPLDASLALRKLARERIAAIDQL
SPSPPRLVEPQPAISASPSPSPALTDSFGRKHDYLRISLTEKCNLRCTYCMPETGNPNLL
PPSHLLTTPEIERVARMFVRQGVRKIRLTGGEPTVRKDLLDVVERLGRLPLTSLGMTSNG
VALPRKLPSLVSAGLTHLNLSLDTLDPLKYELMTRRRGFERVIECLEMAEEMEGLDVKLN
VVVIRGLNDMEVPQFVEMTKNKKITVRFIEYMPFEDNRWSTTKLVPSASLLSTLTALHPT
LTHIPTHKSDTTRHYAVPGWKGKFGFISSMTDHFCGGCSRLRVGADGGMKVCLFGPPVLS
LRPLLRSPAPFSSPESDPDAHIIPHIARAVWGKKFAHDGLGGAEGIKERGRMGAMVGIGA
TEGTSASLAPTAIRARPSTRRTRLSPLSQSARTTAVPLHLLTPTPSPFASTVGIRSFSST
ARRATNDSSRPPDDKRSPASPPSALSSPSTAPPSLTHIDPTTGKASMVSVSQKASTVRSA
TAEGEIYLGASAFSLIDFGDSSSPSSTMKTKKGDVLSIAQLAGLMGSKHTSLLIPLCHPL
SLSHIHVSLSPIPSTHSLRISCTAECVGPTGVEMEALTGVSVAALTVWDMCKAVAGREMR
IGDVRVVRKSGGKSGDWERRD