Protein Info for mRNA_7417 in Rhodosporidium toruloides IFO0880

Name: 15785
Annotation: K03353 APC6, CDC16 anaphase-promoting complex subunit 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 PF12895: ANAPC3" amino acids 127 to 218 (92 residues), 55.7 bits, see alignment E=3.1e-18 PF13181: TPR_8" amino acids 240 to 269 (30 residues), 13.8 bits, see alignment (E = 3.6e-05) amino acids 559 to 587 (29 residues), 15.6 bits, see alignment (E = 1e-05) PF13424: TPR_12" amino acids 519 to 586 (68 residues), 39.3 bits, see alignment E=4.2e-13 PF00515: TPR_1" amino acids 558 to 588 (31 residues), 27.9 bits, see alignment (E = 9.8e-10) PF07719: TPR_2" amino acids 558 to 588 (31 residues), 28.1 bits, see alignment (E = 8.8e-10) PF13176: TPR_7" amino acids 558 to 587 (30 residues), 21 bits, see alignment (E = 1.6e-07) PF13174: TPR_6" amino acids 560 to 589 (30 residues), 14 bits, see alignment (E = 4.3e-05) PF13432: TPR_16" amino acids 560 to 624 (65 residues), 42.6 bits, see alignment E=5.1e-14 PF13414: TPR_11" amino acids 563 to 599 (37 residues), 30.2 bits, see alignment 2e-10 PF13374: TPR_10" amino acids 590 to 619 (30 residues), 18.5 bits, see alignment (E = 9.5e-07)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (727 amino acids)

>mRNA_7417 K03353 APC6, CDC16 anaphase-promoting complex subunit 6 (Rhodosporidium toruloides IFO0880)
MLPHPATATPNLRATPSPFAERINPRSAARKAQYDANTSGNISNEHVEGLRRQSNLSTLS
LSPRRPSLAPSGSTATTRAPRRGTPLAFPANGMDGDDSGFLSQTMDEDAPWTMVDRMRNW
RNDAMTQHLYDSAKFWGGKVLEMTGNPDDAFWLAQIHFLTHQFAQAERILTAPRPSSAAS
TSTAPPARLTDMSLACRYLAAQCMVRLGKWEEALDMVGRRGLGEGYNDGNGDGGIKLTAS
AAHLRGLIHLHMKSNELAKEAFMEALTRDVKCFESFEMLIGGEMMSTEEEWDFVQSLPFH
AQTEDDAEFVRMMYTVRLKKLSHSNDMAIARQRLTDDYGLGEDPDVLFSRADELYNAMRY
VECFKITSHIVLLHPYHRPTLPLHLYCMHHIPNLRSRLFLLAHEMVENEPDDAISWYAVG
LWYFSGKRWEESRRFFGKSVLIDPRFGPAWLAYAHSFAYEGEHDQAITAYSTAQRHLPGS
HLPLLFIGMQHLGLANVSLAEEYLLAAQEICREDPLVVNELGVVALHNQQYEHAVQCFQD
ALLLARRVQSSPSAWSATHLNLGHAYRRLNQWDKAHTSFRRVLELDPRSAAAYSALGIVE
HQRGNVQEAIARYHESLAIAPGDPVTCDLLKLALDDISTRMSSTRFAFPGLPPRVDADLE
EQVRALDEEIRAGETGRLAPPLESEADDVESVVAMQSASPSGIEVDMSEDEEDGGEGETM
DMTGDGG