Protein Info for mRNA_7438 in Rhodosporidium toruloides IFO0880

Name: 15806
Annotation: K01455 E3.5.1.49 formamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF03069: FmdA_AmdA" amino acids 5 to 383 (379 residues), 528.7 bits, see alignment E=3.9e-163

Best Hits

Swiss-Prot: 53% identical to FMDA_SCHPO: Putative formamidase C869.04 (SPAC869.04) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01455, formamidase [EC: 3.5.1.49] (inferred from 68% identity to ppl:POSPLDRAFT_95040)

Predicted SEED Role

"Formamidase (EC 3.5.1.49)" (EC 3.5.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>mRNA_7438 K01455 E3.5.1.49 formamidase (Rhodosporidium toruloides IFO0880)
MLIPVDPLKPASSQRGLMNRWHPDIPAFCTVKPGEVFKLGCHEWTGGQIKNSDNADDVAS
VDLTQIHYLTGPVAVEGAEPGDALVVDLLDITYYEEMPWGYTGVFEEADGGLFATQFKSR
AAKAIWDFEGRFCSSRHIPGVRFAGTTHPGIIGTAPSQELLDKWNKREQELIDQHPGASP
AVALPPEPKGVYVGQDLPKEKLEKIAKEGARTIPGREHGGNCDIKNLSIGSRVYLPVYIP
GANLAIGDLHFSQGDGELSFCGAIEMAGVVTMKTSLIKGGVEKLALTQPIFQPSPIDPMY
AQEVVFEGIGVDIHGDGSQKSMCATTAFKQAALNTMAYLKKLGYTIEQAHLLLSAAPCQS
HVGAIVDVPNACVTMSLPTQIFDRDITPNGMGPDGFEKRDYGQCAIRSDGQRGVDIFDKK