Protein Info for mRNA_7476 in Rhodosporidium toruloides IFO0880

Name: 15844
Annotation: K07243 FTR, FTH1, efeU high-affinity iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 65 to 90 (26 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 162 to 186 (25 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details PF03239: FTR1" amino acids 7 to 334 (328 residues), 219.3 bits, see alignment E=3.7e-69

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 55% identity to ppl:POSPLDRAFT_124512)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>mRNA_7476 K07243 FTR, FTH1, efeU high-affinity iron transporter (Rhodosporidium toruloides IFO0880)
MGNVFSVPIFIITLRETIEAAIIISVLLGLVESLVHEHGDEKGADVVDSLEASERRRLIR
RMRVQIWAGALVGLFIALCIGAAFIAVFFTTLNDLWGKTEEIWEGVFSLIACIIIFVMGV
TMLRIDRSKLKWKAKLAGAFDNKVDASTLTSKDKRQARNSKWTLFVLPLVTVLREGLEAV
VFVGGVSLGQSAKSIPLAAIVGILAGLVIGYLIYASGSRINLSIFLVISTNILFLLGAGL
FSKAVGDFQTYRYNNGVGGDIGETGSGPGSFDPTDGSVWHLTYGNPDNNTSTDGYSIFNA
ILGWTNNATIGTILSYIFYWLAAIVCLVYMKWTEGRTTFFGFKSEAWYRRAARRGAEESR
RNSPDIREKKEIETPTEEDRQFASHV