Protein Info for mRNA_7485 in Rhodosporidium toruloides IFO0880

Name: 15853
Annotation: K08158 MDR1, FLR1, CAF5 MFS transporter, DHA1 family, multidrug resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 129 to 150 (22 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details amino acids 292 to 309 (18 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 444 to 465 (22 residues), see Phobius details amino acids 471 to 495 (25 residues), see Phobius details amino acids 507 to 524 (18 residues), see Phobius details amino acids 530 to 552 (23 residues), see Phobius details PF07690: MFS_1" amino acids 136 to 493 (358 residues), 104.6 bits, see alignment E=2.8e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>mRNA_7485 K08158 MDR1, FLR1, CAF5 MFS transporter, DHA1 family, multidrug resistance protein (Rhodosporidium toruloides IFO0880)
MVADIIRDSTFGQLVNWASKGRYFSYADQRPDYIVRARYFPHASPLPSAESSSTLEARSP
TPKSREETLVNAPGTCAELKTLKTDVDVEKQILESVGAQTPTPPAYEYLVEFEENDPDKP
MNWSSRKRIFIGFLISLLTFGIYIGSAIYTASIPGLMEEFGINQVGATSGLTLFVAAYGI
GPMILSPMQELPRWGRNPVYILGLFAFVIFQIPEILAKNVATVLVFRFLSGFVGSPALAT
GGATMGDIFPLQHIAIAIGAWSVGAISGPIFGPVIGGFAAERMNWRWPFLELLWISGTVL
LIVFLLLPETMESTILIRRAERLRRLTGNPLLRAPAELGHAGEIELAPLLTETIGRAFRL
MLEPALAVAHFYLALVYAIFYLWFEAFPLTFNEIHHFSLGLGGLPYLAFVVAAVPTFIGY
YFYQTRYMASRMAKNPNLAPEARLELAMIGAVFVPVSLLIFGWTARADVHWIWPTIGAGI
YLPGVYYSFQSILIYPKYAASNLAGNDFLRSVFASVFPLFGARYYKVLGIGGGCSLLAGV
SILMIPLLYAIIRFGDRLRARSHFAE