Protein Info for mRNA_7515 in Rhodosporidium toruloides IFO0880

Name: 15883
Annotation: K07827 KRAS, KRAS2 GTPase KRas

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00025: Arf" amino acids 16 to 142 (127 residues), 29.2 bits, see alignment E=9.3e-11 TIGR00231: small GTP-binding protein domain" amino acids 17 to 175 (159 residues), 111.2 bits, see alignment E=2.3e-36 PF00071: Ras" amino acids 20 to 183 (164 residues), 186.4 bits, see alignment E=4.6e-59 PF08477: Roc" amino acids 20 to 138 (119 residues), 67.4 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 78% identical to RASL_COPC7: 24 kDa Ras-like protein (CC-RAS) from Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)

KEGG orthology group: K07974, Ras family, other (inferred from 85% identity to uma:UM00986.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>mRNA_7515 K07827 KRAS, KRAS2 GTPase KRas (Rhodosporidium toruloides IFO0880)
MDSLLIRSHVPQAQFLREYKLVVVGGGGVGKSALTIQFIQSHFVDEYDPTIVSRQDSYRK
QCMIDEEVALLDVLDTAGQEEYSAMREQYMRTGEGFLLVYSITSRNSFDEIGTFHQQILR
VKDKDYFPCIVVANKADLEYERQVGTHEGRELAKHFGCRFIETSAKQRLNVDQAFFDLVR
EIRKYNKEQAAGRPGAAGAAPAQFKEEEQSSAGCCSCVIL