Protein Info for mRNA_7527 in Rhodosporidium toruloides IFO0880

Name: 15895
Annotation: K20031 ZDHHC6 palmitoyltransferase ZDHHC6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details PF01529: DHHC" amino acids 95 to 220 (126 residues), 126.3 bits, see alignment E=4.6e-41

Best Hits

KEGG orthology group: None (inferred from 54% identity to lbc:LACBIDRAFT_145895)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>mRNA_7527 K20031 ZDHHC6 palmitoyltransferase ZDHHC6 (Rhodosporidium toruloides IFO0880)
MGGKLMGRLWVGGVLSLISFIGFSSQVWVVVPSYGWDWRDAELWRILGPFNALLGLVFLN
YGLTVRTDPGTVPKGWEPDWRLVEAGQVEVKKRTGGPRFCRTCRVYKPPRAHHCRQCGRC
ILRMDHHCPWVNNCVGHHNYAHFLRFLFFVDVACSYHLWMISTRAFQSLAFSGNPSTTQV
VLLILNYTACLPVLIAVGIFSLFQFWSLLTNTTTIESWEKDRAASLKRRGKIQEYKYPYH
LTYLQNIQSVLGKNPLLWCWPQPTPGDGLAFPVAHGAGASARASR