Protein Info for mRNA_7534 in Rhodosporidium toruloides IFO0880

Name: 15902
Annotation: K07304 msrA peptide-methionine (S)-S-oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 64 to 218 (155 residues), 192.2 bits, see alignment E=3.4e-61 PF01625: PMSR" amino acids 64 to 217 (154 residues), 202.6 bits, see alignment E=2e-64

Best Hits

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 54% identity to cne:CNG04210)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>mRNA_7534 K07304 msrA peptide-methionine (S)-S-oxide reductase (Rhodosporidium toruloides IFO0880)
MSEMTEAHRTSLFLRQLARCMLLHVRSLFGSAHRMARPTYAGPTLPTAIAASQALPSSSS
GTQTAVVANGCFWGTEHMYRKAFKDKLEDVKVGYTGGHADSPNYRQVCSGSTNHAEACKI
TFDPSKVSYAELIEFHFRMHDPTQVNRQGPDTGTQYRTAIFTTSDEQAEIAKKVMAEVKD
AHYPDQNIATMVEPLAKWWDAEDYHQEYLHNNPGGYECPSHVLHW