Protein Info for mRNA_7543 in Rhodosporidium toruloides IFO0880

Name: 15911
Annotation: KOG1208 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 31 to 238 (208 residues), 95 bits, E=6.6e-31
• PF08659: KR
  • amino acids 34 to 122 (89 residues), 23.9 bits, E=5.2e-09
• PF13561: adh_short_C2
  • amino acids 40 to 274 (235 residues), 59.6 bits, E=5.2e-20

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 46% identity to uma:UM01881.1)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (327 amino acids)

>mRNA_7543 KOG1208 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Rhodosporidium toruloides IFO0880)
MTLLGSIASKAGFSNGRAWDPSTGIPDLTGKVAIVTGGNDGIGFITARELHKKGCKVYLA
CRNEEKAQDAIKRINEASPGKPEGLVFLPFDLTELKSAEKAAKTVQEKEQRLDIIVCNAG
IMAWPYELKNGVECQFWNHLGHFALVKPLLPLLIKTSKEPGAQVRVVSVSSMGHKFAPKP
DFSSLDAVNQNFGSTWTRYGQSKLANILFATALQERLKDENIHVNSLHPGNIHTSLTRGP
VASYGFFGKLMQSISSYAAMTPFEGAKTQLYLAASPEVSEKDYRGKYFVPVATPATPSAY
AQDRELAEQLWKLSEEAIKKADQLASA