Protein Info for mRNA_7552 in Rhodosporidium toruloides IFO0880
Name: 15920
Annotation: K11130 NOP10, NOLA3 H/ACA ribonucleoprotein complex subunit 3
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 76% identical to NOP10_DEBHA: H/ACA ribonucleoprotein complex subunit NOP10 (NOP10) from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968)
KEGG orthology group: K11130, H/ACA ribonucleoprotein complex subunit 3 (inferred from 78% identity to cne:CND01790)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (64 amino acids)
>mRNA_7552 K11130 NOP10, NOLA3 H/ACA ribonucleoprotein complex subunit 3 (Rhodosporidium toruloides IFO0880) MHLMYSLGADGKRLYTLKKATAAGLPTRSAHPARFSPDDKYSRHRVTIKKRFGILLTQKP AKAL