Protein Info for mRNA_7583 in Rhodosporidium toruloides IFO0880

Name: 15951
Annotation: HMMPfam-Polysaccharide deacetylase-PF01522,ProSiteProfiles-NodB homology domain profile.-PS51677,SUPERFAMILY--SSF88713

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF01522: Polysacc_deac_1" amino acids 42 to 146 (105 residues), 51.6 bits, see alignment E=4.3e-18

Best Hits

Swiss-Prot: 54% identical to PGDAE_HELPG: Peptidoglycan deacetylase (pgdA) from Helicobacter pylori (strain G27)

KEGG orthology group: None (inferred from 66% identity to ppl:POSPLDRAFT_47053)

Predicted SEED Role

"Putative polysaccharide deacetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>mRNA_7583 HMMPfam-Polysaccharide deacetylase-PF01522,ProSiteProfiles-NodB homology domain profile.-PS51677,SUPERFAMILY--SSF88713 (Rhodosporidium toruloides IFO0880)
MPRRILCTIGVDVDACAGWLGSYGGEDSPNDMSRGCFAAEVGVPRLLKLFKEKGDMKTSF
YIPGHSLDSFPKEMAMVRDAGHEIGLHGYSHENPVAMTLEQQRAVLDHTYKQLTDFCGKP
PVGSVAPWWEASKEGIELLLEKGIEYDHSSQAHDCMPFYTRDEDTWTKIDFNSTSAHDWM
HPLKKGKLTKLVNIPANWYLADDLPPHMFIKAAPNSHGFVDADVTLKLWKKHFSYFYREY
DWCVFPLTLHPDTAGRPHVLLAVEELIDFINEHEGVEWVTMAQVNKEFREKFPFPGEQQE