Protein Info for mRNA_7599 in Rhodosporidium toruloides IFO0880

Name: 15967
Annotation: K01900 LSC2 succinyl-CoA synthetase beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01016: succinate-CoA ligase, beta subunit
  • amino acids 27 to 419 (393 residues), 423 bits, E=5.4e-131
• PF08442: ATP-grasp_2
  • amino acids 28 to 236 (209 residues), 228.1 bits, E=1.6e-71
• PF01071: GARS_A
  • amino acids 34 to 80 (47 residues), 20.5 bits, 7.3e-08
• PF00549: Ligase_CoA
  • amino acids 296 to 416 (121 residues), 78.9 bits, E=7.8e-26

Best Hits

Swiss-Prot: 56% identical to SUCB_NEOFR: Succinate--CoA ligase [ADP-forming] subunit beta, hydrogenosomal (SCSB) from Neocallimastix frontalis

KEGG orthology group: K01900, succinyl-CoA synthetase beta subunit [EC: 6.2.1.4 6.2.1.5] (inferred from 72% identity to cnb:CNBA7060)

MetaCyc: 56% identical to (ADP-forming) succinyl-CoA ligase beta subunit (Homo sapiens)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• pyruvate fermentation to acetate VI (1/3 steps found)
• itaconate degradation (1/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• methylaspartate cycle (9/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.4, 6.2.1.5

Use Curated BLAST to search for 6.2.1.4 or 6.2.1.5

Protein Sequence (420 amino acids)

>mRNA_7599 K01900 LSC2 succinyl-CoA synthetase beta subunit (Rhodosporidium toruloides IFO0880)
MFASSFRTATRSKALKPSVANQRRNLSIHEYLSMNLLNQYDVPTPKSKAAFSASEAKEVA
QNFGADKLVIKAQVLAGGRGKGHFDGPNGLKGGVQMVDSPEQAEKYAAQMIGHKLITKQT
GAAGRICNAIMLAERRNPTHEYYVAILNDRGLGGPALVASRQGGMNIEDVARDDPSAIVT
TPIPFEDGLSKELAMDIAKKLEFKPESQEKAANIFINLYKLFKEKDATQVEINPLAEVEG
GDVLCMDAKLGFDENAEFRQQDVFKLRDLTQEASSEVEAAKYGLNFIKLDGSIGCLVNGA
GLAMATMDVLNLQGGSPANFLDVGGGATAEAVKKAFELLLADGAVKSIFVNIFGGIMRCD
VIAEGIIMAAKELEMTIPLIVRLQGTKEQEAKELIRNSKMKIFAYDNLDEAAAAAVKAAQ