Protein Info for mRNA_7605 in Rhodosporidium toruloides IFO0880

Name: 15973
Annotation: K03941 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 90 to 211 (122 residues), 155.7 bits, E=2e-50
• PF13237: Fer4_10
  • amino acids 131 to 184 (54 residues), 29.2 bits, E=4.6e-10
• PF00037: Fer4
  • amino acids 131 to 150 (20 residues), 23.3 bits, see alignment (E = 2.3e-08)
  • amino acids 167 to 188 (22 residues), 33.8 bits, see alignment (E = 1.1e-11)
• PF12800: Fer4_4
  • amino acids 132 to 147 (16 residues), 20.9 bits, see alignment (E = 2e-07)
  • amino acids 172 to 185 (14 residues), 10.5 bits, see alignment (E = 0.00044)
• PF12838: Fer4_7
  • amino acids 133 to 187 (55 residues), 49 bits, E=4.1e-16
• PF13187: Fer4_9
  • amino acids 133 to 188 (56 residues), 35.1 bits, E=6.9e-12

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (2/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (233 amino acids)

>mRNA_7605 K03941 NDUFS8 NADH dehydrogenase (ubiquinone) Fe-S protein 8 (Rhodosporidium toruloides IFO0880)
MQAQIARTLAGAAAPRAAAAITARSFATTSAARLATPTTGPEHAGRAPPHSMPVEKARYQ
TAIQTPDYSNGPSALDKAASLFFFSEIARGMAVVLEQFFRPPYTIMYPFEKGPVSSRFRG
EHALRRYASGEERCIACKLCEAICPAQAITIESEAREDGARRTTRYDIDMTKCIYCGFCQ
EACPVDAIVESHNTEYTTETREELLYNKEKLLANGDRMEAELAAAIQSEHPYR