Protein Info for mRNA_7645 in Rhodosporidium toruloides IFO0880

Name: 16013
Annotation: K04794 PTH2 peptidyl-tRNA hydrolase, PTH2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01981: PTH2
  • amino acids 26 to 140 (115 residues), 162.1 bits, E=3e-52
• TIGR00283: peptidyl-tRNA hydrolase
  • amino acids 27 to 140 (114 residues), 147 bits, E=1.4e-47

Best Hits

Swiss-Prot: 46% identical to PTH_METJA: Peptidyl-tRNA hydrolase (pth) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04794, peptidyl-tRNA hydrolase, PTH2 family [EC: 3.1.1.29] (inferred from 55% identity to mgl:MGL_1039)

Predicted SEED Role

"Peptidyl-tRNA hydrolase, archaeal type (EC 3.1.1.29)" in subsystem ZZ gjo need homes (EC 3.1.1.29)

MetaCyc Pathways

• L-cysteine biosynthesis II (tRNA-dependent) (1/3 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.29

Use Curated BLAST to search for 3.1.1.29

Protein Sequence (140 amino acids)

>mRNA_7645 K04794 PTH2 peptidyl-tRNA hydrolase, PTH2 family (Rhodosporidium toruloides IFO0880)
SEYETESEEGDADELKAVKAQGDEPCKLVLVVRSDLNMTKGKIAAQCGHATLACYKTLMR
SNPKLVQHWERTGQAKIAVKCESEEELEILQASAKSLGVCARSIQDAGRTQVDPGTTTVL
GIGPAPVRVVNQVTGHLRLL