Protein Info for mRNA_7680 in Rhodosporidium toruloides IFO0880

Name: 16048
Annotation: K11992 ACOT8, PTE acyl-CoA thioesterase 8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13622: 4HBT_3
  • amino acids 29 to 331 (303 residues), 204.5 bits, E=3.4e-64
• PF02551: Acyl_CoA_thio
  • amino acids 206 to 330 (125 residues), 70 bits, E=1.9e-23

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (335 amino acids)

>mRNA_7680 K11992 ACOT8, PTE acyl-CoA thioesterase 8 (Rhodosporidium toruloides IFO0880)
MPSDAPPTAQSITNAIDLEHVDRDLYRSRELWKPAQGRGVFGGQIIAQAAWAATQSVRRD
EPGTKKGLHSLHCYFLNFGNADIPVLYQVQRLRDGRSYSTRSVLASQQGVPIFSLTCSFC
LAEPDQPVRALPLPQWPLKWHRTEEGQKDPKDVGDRIPEPEECDATEEVMMRALAAAKNL
PKKLQDFVERQAEERRQSSIELRNTDKREIGHLFAFDKTASQQQLYWFRSRAPVEPDPDF
QKCVLAYASDLNFIGTAARATGLGASTKPRLGMLASLDHSMYFYDTTVDAHDWNLFYMNS
PVTSNGRGLVHGRIYKRDGTLAVVCTQEGVVRAAL