Protein Info for mRNA_7683 in Rhodosporidium toruloides IFO0880

Name: 16051
Annotation: K02542 MCM6 DNA replication licensing factor MCM6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 917 PF14551: MCM_N" amino acids 73 to 194 (122 residues), 74.8 bits, see alignment E=2.2e-24 PF17207: MCM_OB" amino acids 201 to 329 (129 residues), 132.9 bits, see alignment E=1.8e-42 PF00493: MCM" amino acids 422 to 644 (223 residues), 340 bits, see alignment E=1.4e-105 PF01078: Mg_chelatase" amino acids 529 to 624 (96 residues), 28.4 bits, see alignment E=3.2e-10 PF17855: MCM_lid" amino acids 659 to 744 (86 residues), 90.9 bits, see alignment E=1.7e-29 PF18263: MCM6_C" amino acids 804 to 914 (111 residues), 93.6 bits, see alignment E=2.8e-30

Best Hits

KEGG orthology group: K02542, minichromosome maintenance protein 6 (inferred from 64% identity to scm:SCHCODRAFT_45848)

Predicted SEED Role

"DNA replication helicase protein MCM" in subsystem DNA replication, archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (917 amino acids)

>mRNA_7683 K02542 MCM6 DNA replication licensing factor MCM6 (Rhodosporidium toruloides IFO0880)
MATPAHNTDPMSDDRTVRGSEAEAVEVGANGKRAPRNGAQGGAGGKAQRVRIQRDYADIP
AVKDETGEKVAQLFEGFLEQFSEEDPRALPTSSLTSGGPSSTASRVHFYIEQVKGMEEFK
LTTLYVDYQHLHDAHELLAKAITQQYYRFLPYLRRALQNLVKKYAPTYLYLNAHTASTVA
SGLSVRQFNIAFYNLPLVEGIRDMRTDKIGKLSSISGTVTRTSEVRPELTFGTFTCLVCH
GMVRDVEQQFKYTEPSMCPNISCSNRSAWKLNIEQSKFSDWQKVRIQENPNEIPTGSMPR
SLDVILRAEIVERAKAGDKVIFTGTFIVVPDVAALGLPGVNAEMMRENQGGRGGGPGAMG
GNLGVSGLKSLGVKDLTYKTAFLACMATSADVRSTAANIRSDDQGVEENRKEFLESLTKE
EVQHLESMVRSDHIYSRLVSSIAPTVYGHEIVKKGILLQLMGGVHKQTPEGMHLRGDLNV
CIVGDPSVSKSQFLKYVCGFLPRAVYTSGKASSAAGLTAAVVKDEETGEFTIEAGALMLA
DNGICAIDEFDKMDLSDQVAIHEAMEQQTISIAKAGIQATLNARTSILAAANPVGGRYNK
KMSLRANVAMSAPIMSRFDLFFVVLDECNEDVDLKLAQHIVNIHMHKNAALNPEFSTDEL
QRYIRYARTFNPKLTPEASKQLVTLYGKLRSEDAQGYGRSSYRVTVRQLESMVRLSEAIA
RANCTDVITVEFVNEAYNLLSQSIIHVEKDDVDIDSDDEDDDDDPELGGGGDGEEGQAGP
GSPARDRTASATPAPAPAQQPKKPKVTISYDKYMLMMQRIVYMIAQHEKEEGAGMPRSAV
ASQYLDEIEDQINSIDQLEEETVLVDKVLTKLVKERYLLELRGSTNVQEGQDGDEMAADE
EDEPVLTVHPECDVLEA