Protein Info for mRNA_7700 in Rhodosporidium toruloides IFO0880

Name: 16068
Annotation: HMMPfam-14-3-3 protein-PF00244,PRINTS-14-3-3 protein zeta signature-PR00305,ProSitePatterns-14-3-3 proteins signature 1.-PS00796,SMART-14-3-3 homologues-SM00101,SUPERFAMILY--SSF48445

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00244: 14-3-3
  • amino acids 51 to 257 (207 residues), 315.1 bits, E=1.2e-98

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• glycerol degradation to butanol (11/16 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.1

Use Curated BLAST to search for 5.3.1.1

Protein Sequence (351 amino acids)

>mRNA_7700 HMMPfam-14-3-3 protein-PF00244,PRINTS-14-3-3 protein zeta signature-PR00305,ProSitePatterns-14-3-3 proteins signature 1.-PS00796,SMART-14-3-3 homologues-SM00101,SUPERFAMILY--SSF48445 (Rhodosporidium toruloides IFO0880)
SAEQDRAEAIYMAKLSEQAERYDEVRPRSLFPLPHLPLHMHIRPSPPSLRMVSQMKSIAS
LNSELSIEERNLLSVAYKNVIGARRASWRIVSSIEGKEEAKGNTTQVQAIKAYREKIEKE
LADICEDILSVLEKHLIPSAESGESKVFYHKMKGDYHRYLAEFATGDVRGKNADASLEAY
KNASQIASQELAPTHPIRLGLALNFSVFYYEILNSPDKACSLAKTAFDDAIAELDTLSEE
SYKDSTLIMQLLRDNLRAPLDVRPLRGSSRRTQGRGPARAGTGDRRGGCLSVSHPLCTSR
LLSLFASFSSHHACVPRVFSFVGEENTSLRTSTRLLRRFVKTLARGMRKER