Protein Info for mRNA_7769 in Rhodosporidium toruloides IFO0880

Name: 16137
Annotation: KOG2504 Monocarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 117 to 138 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 420 to 444 (25 residues), see Phobius details amino acids 455 to 479 (25 residues), see Phobius details amino acids 489 to 509 (21 residues), see Phobius details PF07690: MFS_1" amino acids 130 to 411 (282 residues), 78.6 bits, see alignment E=2.3e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>mRNA_7769 KOG2504 Monocarboxylate transporter (Rhodosporidium toruloides IFO0880)
MSSTTVVNDPPRPATRPVYTGGSLARIVTSNQLLPTESLISQRGGAAELRERERDGLEAG
LTRQCVDEKGRRPVDGGEAEVGERGGGGGVEERDVVLTDGKEGVAEEWTFPDGGWRAWSV
VFGCWLCACNVQGYGMAWGALVGDLRKNHHPSSSLATLNLIVGLFNFGLNASPFITGRLG
ELFGFKRMIAIGITISICLLVISACAVDSLPALFVCQGFLLGCAHGISLPLFMTLPSQWF
SKRRGLATGMVVSGAGFGGGAASLILRAILPSLGYRYSLLVYAAISTVTYIIGWSLLKVR
KPPLRAVPQRFDTKTGLPPGIWRDGAFYSLMASVSIGVWGFLSPFYYLTEFTTKNNPSLD
PNSLVVAVPLIVANFALAIGRVGAGLFADRIGPANAMLLTFFAGGILQLAFWSQLGEGQF
GATIAFAVLFGLFGSSFFLLMPAVASQLFGLRGLATITGWVVTSQSPGQLAGATVAGVVL
TSAGGYSGVAYYAGAMMLGGAMLILPARFMRERRLFARY