Protein Info for mRNA_7776 in Rhodosporidium toruloides IFO0880

Name: 16144
Annotation: K01899 LSC1 succinyl-CoA synthetase alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01019: succinate-CoA ligase, alpha subunit
  • amino acids 43 to 329 (287 residues), 415.5 bits, E=5.6e-129
• PF02629: CoA_binding
  • amino acids 45 to 135 (91 residues), 101.5 bits, E=6.9e-33
• PF13380: CoA_binding_2
  • amino acids 75 to 165 (91 residues), 28.1 bits, E=5e-10
• PF13607: Succ_CoA_lig
  • amino acids 186 to 323 (138 residues), 37 bits, E=5.7e-13
• PF00549: Ligase_CoA
  • amino acids 192 to 314 (123 residues), 77.4 bits, E=2.2e-25

Best Hits

Swiss-Prot: 69% identical to SUCA_DROME: Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (Scsalpha1) from Drosophila melanogaster

KEGG orthology group: K01899, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.4 6.2.1.5] (inferred from 70% identity to cci:CC1G_10272)

MetaCyc: 64% identical to succinyl-CoA ligase alpha subunit (Homo sapiens)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]; Succinate--CoA ligase (GDP-forming). [EC: 6.2.1.5, 6.2.1.4]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• pyruvate fermentation to acetate VI (1/3 steps found)
• itaconate degradation (1/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• methylaspartate cycle (9/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.4, 6.2.1.5

Use Curated BLAST to search for 6.2.1.4 or 6.2.1.5

Protein Sequence (337 amino acids)

>mRNA_7776 K01899 LSC1 succinyl-CoA synthetase alpha subunit (Rhodosporidium toruloides IFO0880)
MVVRLAARSILKQAPRRAFATSRAQQSSLSLYDQTVPNLRLRPDSTVICQGFTGKTATFH
CREALEFGTKLVGGVSPKKAGTEHLGLPVFGSVREANEKTKPDATVIYVPPPFAADAIIE
AIEAEIPLIVCITEGIPQQDEVRVAQALRRQTKSRLVGPNCPGIIAPAPNGGGCKIGIMP
GNIFTPGSVGVVSRSGTLTYEAVDATTKIGLGQSLCVGIGGDPFPGSQHIDVLKVFMEDE
ATKGIVLIGEIGGSMEEEAAEYLEKYNVQKKPVVGFIAGRTAPPGRRMGHAGAVISGGKG
KAEDKVKALEKAGVIMVDSPAQLGSSLKKAMVDAGLA